SLC7A7 Antikörper
-
- Target Alle SLC7A7 (Slc7a7) Antikörper anzeigen
- SLC7A7 (Slc7a7) (Solute Carrier Family 7 (Amino Acid Transporter Light Chain, Y+L System), Member 7 (Slc7a7))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC7A7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC7 A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI
- Top Product
- Discover our top product Slc7a7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC7A7 Blocking Peptide, catalog no. 33R-9952, is also available for use as a blocking control in assays to test for specificity of this SLC7A7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A7 (Slc7a7) (Solute Carrier Family 7 (Amino Acid Transporter Light Chain, Y+L System), Member 7 (Slc7a7))
- Andere Bezeichnung
- SLC7A7 (Slc7a7 Produkte)
- Synonyme
- LAT3 antikoerper, LPI antikoerper, MOP-2 antikoerper, Y+LAT1 antikoerper, y+LAT-1 antikoerper, y+LAT1 antikoerper, AI790233 antikoerper, my+lat1 antikoerper, solute carrier family 7 member 7 antikoerper, solute carrier family 7 (cationic amino acid transporter, y+ system), member 7 antikoerper, SLC7A7 antikoerper, Slc7a7 antikoerper
- Hintergrund
- The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene.
- Molekulargewicht
- 56 kDa (MW of target protein)
-