Slc30a3 Antikörper
-
- Target Alle Slc30a3 Antikörper anzeigen
- Slc30a3 (Solute Carrier Family 30 (Zinc Transporter), Member 3 (Slc30a3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Slc30a3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC30 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLG
- Top Product
- Discover our top product Slc30a3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC30A3 Blocking Peptide, catalog no. 33R-1388, is also available for use as a blocking control in assays to test for specificity of this SLC30A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Slc30a3 (Solute Carrier Family 30 (Zinc Transporter), Member 3 (Slc30a3))
- Andere Bezeichnung
- SLC30A3 (Slc30a3 Produkte)
- Synonyme
- pp12488 antikoerper, slc30a3 antikoerper, znt-2 antikoerper, znt2 antikoerper, ZnT3 antikoerper, ZNT3 antikoerper, Znt3 antikoerper, T32F6.21 antikoerper, T32F6_21 antikoerper, zinc transporter 3 precursor antikoerper, solute carrier family 30 member 2 antikoerper, solute carrier family 30 member 3 antikoerper, solute carrier family 30 (zinc transporter), member 3 antikoerper, zinc transporter 3 precursor antikoerper, slc30a2 antikoerper, SLC30A3 antikoerper, Slc30a3 antikoerper, ZIP3 antikoerper
- Hintergrund
- SLC30A3 is involved in accumulation of zinc in synaptic vesicles.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-