SECTM1 Antikörper (Middle Region)

Produktnummer ABIN635331

Produktdetails anti-SECTM1 Antikörper

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SECTM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SECTM1 antibody was raised against the middle region of SECTM1

Aufreinigung: Affinity purified

Immunogen: SECTM1 antibody was raised using the middle region of SECTM1 corresponding to a region with amino acids ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SECTM1 Blocking Peptide, catalog no. 33R-1467, is also available for use as a blocking control in assays to test for specificity of this SECTM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SECTM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SECTM1

Target: SECTM1 (Secreted and Transmembrane 1 (SECTM1))

Andere Bezeichnung: SECTM1 (SECTM1 Produkte)

Synonyme: K12 antikoerper, secreted and transmembrane 1 antikoerper, SECTM1 antikoerper

Hintergrund: This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.

Molekulargewicht: 27 kDa (MW of target protein)