-
- Target Alle SLC27A3 (FATP3) Antikörper anzeigen
- SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC27A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC27 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP
- Top Product
- Discover our top product FATP3 Primärantikörper
-
anti-Fatty Acid Transport Protein 3 (FATP3) (AA 124-152), (N-Term) antibody
FATP3 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB32917 unconjugated
anti-Fatty Acid Transport Protein 3 (FATP3) (AA 503-552) antibodyFATP3 Reaktivität: Human, Maus, Schaf, Rind (Kuh), Hund, Meerschweinchen, Affe, Schwein, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Fatty Acid Transport Protein 3 (FATP3) (Middle Region) antibodyFATP3 Reaktivität: Human, Maus, Ratte, Schaf, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC27A3 Blocking Peptide, catalog no. 33R-7087, is also available for use as a blocking control in assays to test for specificity of this SLC27A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))
- Andere Bezeichnung
- SLC27A3 (FATP3 Produkte)
- Synonyme
- ACSVL3 antikoerper, FATP3 antikoerper, VLCS-3 antikoerper, Acsvl3 antikoerper, Vlcs-3 antikoerper, solute carrier family 27 member 3 antikoerper, solute carrier family 27 (fatty acid transporter), member 3 antikoerper, Slc27a3 antikoerper, SLC27A3 antikoerper
- Hintergrund
- SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity.
- Molekulargewicht
- 79 kDa (MW of target protein)
-
Sie sind hier:
