SLC27A3 Antikörper

Produktnummer ABIN635324

Der Kaninchen Polyklonal anti-SLC27A3 Antikörper wird verwendet zum Nachweis von SLC27A3 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für SLC27A3 Antikörper (ABIN635324)

Target: SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC27A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC27A3 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC27 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC27A3 Blocking Peptide, (ABIN5616233), is also available for use as a blocking control in assays to test for specificity of this SLC27A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC27A3

Target: SLC27A3 (FATP3) (Fatty Acid Transport Protein 3 (FATP3))

Andere Bezeichnung: SLC27A3

Hintergrund: SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity.

Molekulargewicht: 79 kDa (MW of target protein)