SLC25A25 Antikörper
-
- Target Alle SLC25A25 Antikörper anzeigen
- SLC25A25 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A25 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC25 A25 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLR
- Top Product
- Discover our top product SLC25A25 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A25 Blocking Peptide, catalog no. 33R-4541, is also available for use as a blocking control in assays to test for specificity of this SLC25A25 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 25 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A25 (Solute Carrier Family 25 (Mitochondrial Carrier, Phosphate Carrier), Member 25 (SLC25A25))
- Andere Bezeichnung
- SLC25A25 (SLC25A25 Produkte)
- Synonyme
- MCSC antikoerper, PCSCL antikoerper, RP11-395P17.4 antikoerper, SCAMC-2 antikoerper, 1110030N17Rik antikoerper, mKIAA1896 antikoerper, Mcsc antikoerper, Pcscl antikoerper, mcsc antikoerper, pcscl antikoerper, scamc-2 antikoerper, scamc2 antikoerper, slc25a antikoerper, slc25a25 antikoerper, wu:fb13d12 antikoerper, wu:fd14e03 antikoerper, zgc:77454 antikoerper, SLC25A25 antikoerper, solute carrier family 25 member 25 antikoerper, solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 25 antikoerper, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 L homeolog antikoerper, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25a antikoerper, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 antikoerper, SLC25A25 antikoerper, Slc25a25 antikoerper, slc25a25.L antikoerper, slc25a25a antikoerper, slc25a25 antikoerper
- Hintergrund
- SLC25A25 may be involved in muscle function.
- Molekulargewicht
- 53 kDa (MW of target protein)
-