TMEM79 Antikörper (C-Term)

Produktnummer ABIN635317

Produktdetails anti-TMEM79 Antikörper

Target: TMEM79 (Transmembrane Protein 79 (TMEM79))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM79 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM79 antibody was raised against the C terminal of TMEM79

Aufreinigung: Affinity purified

Immunogen: TMEM79 antibody was raised using the C terminal of TMEM79 corresponding to a region with amino acids LPLLSMLMWNLYYMFVVEPERMLTATESRLDYPDHARSASDYRPRPWG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM79 Blocking Peptide, catalog no. 33R-5272, is also available for use as a blocking control in assays to test for specificity of this TMEM79 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM79 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM79

Target: TMEM79 (Transmembrane Protein 79 (TMEM79))

Andere Bezeichnung: TMEM79 (TMEM79 Produkte)

Synonyme: 2310042N02Rik antikoerper, 2310074C17Rik antikoerper, RGD1309886 antikoerper, transmembrane protein 79 antikoerper, TMEM79 antikoerper, Tmem79 antikoerper

Hintergrund: TMEM79 is a multi-pass membrane protein. The exact function of TMEM79 remains unknown.

Molekulargewicht: 43 kDa (MW of target protein)