NRSN2 Antikörper (Middle Region)

Produktnummer ABIN635316

Produktdetails anti-NRSN2 Antikörper

Target: NRSN2 (Neurensin 2 (NRSN2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NRSN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Neurensin 2 antibody was raised against the middle region of NRSN2

Aufreinigung: Affinity purified

Immunogen: Neurensin 2 antibody was raised using the middle region of NRSN2 corresponding to a region with amino acids LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Neurensin 2 Blocking Peptide, catalog no. 33R-5159, is also available for use as a blocking control in assays to test for specificity of this Neurensin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRSN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NRSN2

Target: NRSN2 (Neurensin 2 (NRSN2))

Andere Bezeichnung: Neurensin 2 (NRSN2 Produkte)

Synonyme: C20orf98 antikoerper, dJ1103G7.6 antikoerper, Gm123 antikoerper, Neurensin-2 antikoerper, neurensin 2 antikoerper, NRSN2 antikoerper, Nrsn2 antikoerper

Hintergrund: NRSN2 may play a role in maintenance and/or transport of vesicles.

Molekulargewicht: 22 kDa (MW of target protein)