TMEM106C Antikörper (Middle Region)

Produktnummer ABIN635314

Produktdetails anti-TMEM106C Antikörper

Target: TMEM106C (Transmembrane Protein 106C (TMEM106C))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM106C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM106 C antibody was raised against the middle region of TMEM106

Aufreinigung: Affinity purified

Immunogen: TMEM106 C antibody was raised using the middle region of TMEM106 corresponding to a region with amino acids NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM106C Blocking Peptide, catalog no. 33R-6694, is also available for use as a blocking control in assays to test for specificity of this TMEM106C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM100 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM106C

Target: TMEM106C (Transmembrane Protein 106C (TMEM106C))

Andere Bezeichnung: TMEM106C (TMEM106C Produkte)

Synonyme: MGC53571 antikoerper, tmem106C antikoerper, AI046681 antikoerper, BC046621 antikoerper, D15Ertd405e antikoerper, RGD1311532 antikoerper, transmembrane protein 106C L homeolog antikoerper, transmembrane protein 106C antikoerper, tmem106c.L antikoerper, TMEM106C antikoerper, tmem106c antikoerper, Tmem106c antikoerper

Hintergrund: TMEM106C belongs to the TMEM106 family. The exact function of TMEM106C remains unknown.

Molekulargewicht: 28 kDa (MW of target protein)