TMEM106C Antikörper (Middle Region)

Produktnummer ABIN635314

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch TMEM106C in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für TMEM106C Antikörper (Middle Region) (ABIN635314)

Target: TMEM106C (Transmembrane Protein 106C (TMEM106C))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM106C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM106C Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMEM106 C antibody was raised against the middle region of TMEM106

Aufreinigung: Affinity purified

Immunogen: TMEM106 C antibody was raised using the middle region of TMEM106 corresponding to a region with amino acids NFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM106C Blocking Peptide, (ABIN5616653), is also available for use as a blocking control in assays to test for specificity of this TMEM106C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM100 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM106C

Target: TMEM106C (Transmembrane Protein 106C (TMEM106C))

Andere Bezeichnung: TMEM106C

Hintergrund: TMEM106C belongs to the TMEM106 family. The exact function of TMEM106C remains unknown.

Molekulargewicht: 28 kDa (MW of target protein)