CST9 Antikörper

Produktnummer ABIN635300

Produktdetails anti-CST9 Antikörper

Target: CST9 (Cystatin 9 (Testatin) (CST9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CST9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: Cystatin 9 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cystatin 9 Blocking Peptide, catalog no. 33R-3925, is also available for use as a blocking control in assays to test for specificity of this Cystatin 9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CST9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CST9

Target: CST9 (Cystatin 9 (Testatin) (CST9))

Andere Bezeichnung: Cystatin 9 (CST9 Produkte)

Synonyme: M12 antikoerper, cresp antikoerper, testatin antikoerper, CLM antikoerper, CTES7A antikoerper, cystatin 9 antikoerper, cystatin-9 antikoerper, Cst9 antikoerper, CST9 antikoerper, LOC781567 antikoerper

Hintergrund: CST9 is part of the cystatin superfamily which encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions.

Molekulargewicht: 18 kDa (MW of target protein)