SLCO2B1 Antikörper (N-Term)

Produktnummer ABIN635293

Produktdetails anti-SLCO2B1 Antikörper

Target: SLCO2B1 (Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLCO2B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLCO2 B1 antibody was raised against the N terminal of SLCO2 1

Aufreinigung: Affinity purified

Immunogen: SLCO2 B1 antibody was raised using the N terminal of SLCO2 1 corresponding to a region with amino acids DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLCO2B1 Blocking Peptide, catalog no. 33R-2111, is also available for use as a blocking control in assays to test for specificity of this SLCO2B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLCO2B1

Target: SLCO2B1 (Solute Carrier Organic Anion Transporter Family, Member 2B1 (SLCO2B1))

Andere Bezeichnung: SLCO2B1 (SLCO2B1 Produkte)

Synonyme: OATP2B1 antikoerper, DKFZp469P0119 antikoerper, im:7158298 antikoerper, wu:fi40d02 antikoerper, zgc:123236 antikoerper, OATP-B antikoerper, OATPB antikoerper, SLC21A9 antikoerper, AI060904 antikoerper, AI852653 antikoerper, Slc21a9 antikoerper, moat1 antikoerper, solute carrier organic anion transporter family member 2B1 antikoerper, solute carrier organic anion transporter family, member 2B1 antikoerper, solute carrier organic anion transporter family member 2B1 L homeolog antikoerper, solute carrier organic anion transporter family, member 2b1 antikoerper, SLCO2B1 antikoerper, slco2b1 antikoerper, slco2b1.L antikoerper, Slco2b1 antikoerper

Hintergrund: SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.

Molekulargewicht: 77 kDa (MW of target protein)