CCL17 Antikörper

Produktnummer ABIN635290

Produktdetails anti-CCL17 Antikörper

Target: CCL17 (Chemokine (C-C Motif) Ligand 17 (CCL17))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCL17 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ABCD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNELCKILGEDSVLKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ABCD2 Blocking Peptide, catalog no. 33R-10001, is also available for use as a blocking control in assays to test for specificity of this ABCD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CCL17

Target: CCL17 (Chemokine (C-C Motif) Ligand 17 (CCL17))

Andere Bezeichnung: ABCD2 (CCL17 Produkte)

Synonyme: A-152E5.3 antikoerper, ABCD-2 antikoerper, SCYA17 antikoerper, TARC antikoerper, CCL17 antikoerper, Abcd-2 antikoerper, Scya17 antikoerper, Scya17l antikoerper, Tarc antikoerper, abcd2 antikoerper, C-C motif chemokine ligand 17 antikoerper, chemokine (C-C motif) ligand 17 antikoerper, ATP-binding cassette sub-family D member 2 antikoerper, CCL17 antikoerper, Ccl17 antikoerper, LOC100537809 antikoerper

Hintergrund: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Molekulargewicht: 83 kDa (MW of target protein)