LDLRAD1 Antikörper (Middle Region)
-
- Target Alle LDLRAD1 Produkte
- LDLRAD1 (Low Density Lipoprotein Receptor Class A Domain Containing 1 (LDLRAD1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LDLRAD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LDLRAD1 antibody was raised against the middle region of LDLRAD1
- Aufreinigung
- Affinity purified
- Immunogen
- LDLRAD1 antibody was raised using the middle region of LDLRAD1 corresponding to a region with amino acids DEDESLCRDVPQSLPHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSP
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LDLRAD1 Blocking Peptide, catalog no. 33R-1894, is also available for use as a blocking control in assays to test for specificity of this LDLRAD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LDLRAD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." in: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).
: "
-
A chimeric LDL receptor containing the cytoplasmic domain of the transferrin receptor is degraded by PCSK9." in: Molecular genetics and metabolism, Vol. 99, Issue 2, pp. 149-56, (2010) (PubMed).
-
- Target
- LDLRAD1 (Low Density Lipoprotein Receptor Class A Domain Containing 1 (LDLRAD1))
- Andere Bezeichnung
- LDLRAD1 (LDLRAD1 Produkte)
- Synonyme
- OTTMUSG00000008594 antikoerper, low density lipoprotein receptor class A domain containing 1 antikoerper, LDLRAD1 antikoerper, Ldlrad1 antikoerper
- Hintergrund
- The function of LDLRAD1 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 22 kDa (MW of target protein)
-