RNF185 Antikörper (Middle Region)

Produktnummer ABIN635239

Produktdetails anti-RNF185 Antikörper

Target: RNF185 (Ring Finger Protein 185 (RNF185))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RNF185 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNF185 antibody was raised against the middle region of RNF185

Aufreinigung: Affinity purified

Immunogen: RNF185 antibody was raised using the middle region of RNF185 corresponding to a region with amino acids QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNF185 Blocking Peptide, catalog no. 33R-7767, is also available for use as a blocking control in assays to test for specificity of this RNF185 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF185 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RNF185

Target: RNF185 (Ring Finger Protein 185 (RNF185))

Andere Bezeichnung: RNF185 (RNF185 Produkte)

Synonyme: zgc:73070 antikoerper, xrnf185 antikoerper, 1700022N24Rik antikoerper, AL033296 antikoerper, ring finger protein 185 antikoerper, ring finger protein 185 L homeolog antikoerper, rnf185 antikoerper, rnf185.L antikoerper, RNF185 antikoerper, Rnf185 antikoerper

Hintergrund: The exact function of RNF185 remains unknown.

Molekulargewicht: 20 kDa (MW of target protein)