RNF185 Antikörper (Middle Region)
-
- Target Alle RNF185 Antikörper anzeigen
- RNF185 (Ring Finger Protein 185 (RNF185))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF185 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RNF185 antibody was raised against the middle region of RNF185
- Aufreinigung
- Affinity purified
- Immunogen
- RNF185 antibody was raised using the middle region of RNF185 corresponding to a region with amino acids QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF
- Top Product
- Discover our top product RNF185 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNF185 Blocking Peptide, catalog no. 33R-7767, is also available for use as a blocking control in assays to test for specificity of this RNF185 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF185 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF185 (Ring Finger Protein 185 (RNF185))
- Andere Bezeichnung
- RNF185 (RNF185 Produkte)
- Synonyme
- zgc:73070 antikoerper, xrnf185 antikoerper, 1700022N24Rik antikoerper, AL033296 antikoerper, ring finger protein 185 antikoerper, ring finger protein 185 L homeolog antikoerper, rnf185 antikoerper, rnf185.L antikoerper, RNF185 antikoerper, Rnf185 antikoerper
- Hintergrund
- The exact function of RNF185 remains unknown.
- Molekulargewicht
- 20 kDa (MW of target protein)
-