SLC7A4 Antikörper
-
- Target Alle SLC7A4 Antikörper anzeigen
- SLC7A4 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC7A4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC7 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMN
- Top Product
- Discover our top product SLC7A4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC7A4 Blocking Peptide, catalog no. 33R-3182, is also available for use as a blocking control in assays to test for specificity of this SLC7A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC7A4 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 4 (SLC7A4))
- Andere Bezeichnung
- SLC7A4 (SLC7A4 Produkte)
- Synonyme
- MGC83777 antikoerper, SLC7A4 antikoerper, MGC147458 antikoerper, si:busm1-266f07.3 antikoerper, si:dz266f07.3 antikoerper, AI853530 antikoerper, CAT-4 antikoerper, CAT4 antikoerper, HCAT3 antikoerper, VH antikoerper, solute carrier family 7 member 4 antikoerper, solute carrier family 7 member 4 L homeolog antikoerper, cationic amino acid transporter 4 antikoerper, solute carrier family 7, member 4 antikoerper, solute carrier family 7 (cationic amino acid transporter, y+ system), member 4 antikoerper, SLC7A4 antikoerper, slc7a4.L antikoerper, slc7a4 antikoerper, LOC100056096 antikoerper, Slc7a4 antikoerper
- Hintergrund
- SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).
- Molekulargewicht
- 68 kDa (MW of target protein)
-