TCTN3 Antikörper (Middle Region)
-
- Target Alle TCTN3 Antikörper anzeigen
- TCTN3 (Tectonic Family Member 3 (TCTN3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TCTN3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TCTN3 antibody was raised against the middle region of TCTN3
- Aufreinigung
- Affinity purified
- Immunogen
- TCTN3 antibody was raised using the middle region of TCTN3 corresponding to a region with amino acids LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS
- Top Product
- Discover our top product TCTN3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TCTN3 Blocking Peptide, catalog no. 33R-5493, is also available for use as a blocking control in assays to test for specificity of this TCTN3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTN3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TCTN3 (Tectonic Family Member 3 (TCTN3))
- Andere Bezeichnung
- TCTN3 (TCTN3 Produkte)
- Synonyme
- RGD1305166 antikoerper, C10orf61 antikoerper, JBTS18 antikoerper, OFD4 antikoerper, TECT3 antikoerper, 4930521E07Rik antikoerper, AI197391 antikoerper, Tect3 antikoerper, tectonic family member 3 antikoerper, Tctn3 antikoerper, TCTN3 antikoerper
- Hintergrund
- TCTN3 may be involved in apoptosis regulation.
- Molekulargewicht
- 64 kDa (MW of target protein)
-