TRAF3IP3 Antikörper (Middle Region)
-
- Target Alle TRAF3IP3 Antikörper anzeigen
- TRAF3IP3 (TRAF3 Interacting Protein 3 (TRAF3IP3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRAF3IP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRAF3 IP3 antibody was raised against the middle region of TRAF3 P3
- Aufreinigung
- Affinity purified
- Immunogen
- TRAF3 IP3 antibody was raised using the middle region of TRAF3 P3 corresponding to a region with amino acids KQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYS
- Top Product
- Discover our top product TRAF3IP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRAF3IP3 Blocking Peptide, catalog no. 33R-4606, is also available for use as a blocking control in assays to test for specificity of this TRAF3IP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAF0 P3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRAF3IP3 (TRAF3 Interacting Protein 3 (TRAF3IP3))
- Andere Bezeichnung
- TRAF3IP3 (TRAF3IP3 Produkte)
- Synonyme
- DJ434O14.3 antikoerper, T3JAM antikoerper, 6030423D04Rik antikoerper, AI115021 antikoerper, T3jam antikoerper, RGD1304848 antikoerper, TRAF3 interacting protein 3 antikoerper, TRAF3IP3 antikoerper, Traf3ip3 antikoerper
- Hintergrund
- TRAF3IP3 stimulated cell growth by modulating the c-Jun N-terminal kinase (JNK) pathway. TRAF3 interacts with Smac/DIABLO via TRAF domain, leading to an increased proapoptotic effect of Smac/DIABLO in cytoplasm.
- Molekulargewicht
- 61 kDa (MW of target protein)
-