SIGIRR Antikörper

Produktnummer ABIN635203

Produktdetails anti-SIGIRR Antikörper

Target: SIGIRR (Single Immunoglobulin and Toll-Interleukin 1 Receptor (TIR) Domain (SIGIRR))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIGIRR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SIGIRR antibody was raised using a synthetic peptide corresponding to a region with amino acids PVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYSARTDFYCLVSKDDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIGIRR Blocking Peptide, catalog no. 33R-7406, is also available for use as a blocking control in assays to test for specificity of this SIGIRR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGIRR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIGIRR

Target: SIGIRR (Single Immunoglobulin and Toll-Interleukin 1 Receptor (TIR) Domain (SIGIRR))

Andere Bezeichnung: SIGIRR (SIGIRR Produkte)

Synonyme: TIR8 antikoerper, AI256711 antikoerper, sc:d148 antikoerper, RGD1306732 antikoerper, single Ig and TIR domain containing antikoerper, single immunoglobulin and toll-interleukin 1 receptor (TIR) domain antikoerper, SIGIRR antikoerper, Sigirr antikoerper, sigirr antikoerper

Hintergrund: SIGIRR acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through a TIR-TIR domain interaction with TLR4. Through its extracellular domain it interferes with the heterodimerization of Il1R1 and IL1RAP.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Toll-Like Receptors Cascades