SSR1 Antikörper (Middle Region)
-
- Target Alle SSR1 Antikörper anzeigen
- SSR1 (Signal Sequence Receptor, alpha (SSR1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SSR1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SSR1 antibody was raised against the middle region of SSR1
- Aufreinigung
- Affinity purified
- Immunogen
- SSR1 antibody was raised using the middle region of SSR1 corresponding to a region with amino acids FTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEY
- Top Product
- Discover our top product SSR1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SSR1 Blocking Peptide, catalog no. 33R-3096, is also available for use as a blocking control in assays to test for specificity of this SSR1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SSR1 (Signal Sequence Receptor, alpha (SSR1))
- Andere Bezeichnung
- SSR1 (SSR1 Produkte)
- Synonyme
- cb758 antikoerper, trapa antikoerper, Ssr1 antikoerper, TRAPA antikoerper, 2510001K09Rik antikoerper, 6330400D04 antikoerper, AI159733 antikoerper, AI452176 antikoerper, SSR antikoerper, signal sequence receptor, alpha antikoerper, signal sequence receptor, alpha (translocon-associated protein alpha) antikoerper, signal sequence receptor subunit 1 antikoerper, signal sequence receptor, alpha (translocon-associated protein alpha) S homeolog antikoerper, ssr1 antikoerper, SSR1 antikoerper, Ssr1 antikoerper, ssr1.S antikoerper
- Hintergrund
- The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein encoded by this gene and a 22 kDa glycoprotein.
- Molekulargewicht
- 32 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-