SSR1 Antikörper (Middle Region)

Produktnummer ABIN635192

Produktdetails anti-SSR1 Antikörper

Target: SSR1 (Signal Sequence Receptor, alpha (SSR1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SSR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SSR1 antibody was raised against the middle region of SSR1

Aufreinigung: Affinity purified

Immunogen: SSR1 antibody was raised using the middle region of SSR1 corresponding to a region with amino acids FTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SSR1 Blocking Peptide, catalog no. 33R-3096, is also available for use as a blocking control in assays to test for specificity of this SSR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SSR1

Target: SSR1 (Signal Sequence Receptor, alpha (SSR1))

Andere Bezeichnung: SSR1 (SSR1 Produkte)

Synonyme: cb758 antikoerper, trapa antikoerper, Ssr1 antikoerper, TRAPA antikoerper, 2510001K09Rik antikoerper, 6330400D04 antikoerper, AI159733 antikoerper, AI452176 antikoerper, SSR antikoerper, signal sequence receptor, alpha antikoerper, signal sequence receptor, alpha (translocon-associated protein alpha) antikoerper, signal sequence receptor subunit 1 antikoerper, signal sequence receptor, alpha (translocon-associated protein alpha) S homeolog antikoerper, ssr1 antikoerper, SSR1 antikoerper, Ssr1 antikoerper, ssr1.S antikoerper

Hintergrund: The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein encoded by this gene and a 22 kDa glycoprotein.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling