SPOCK3 Antikörper
-
- Target Alle SPOCK3 Antikörper anzeigen
- SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPOCK3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMND
- Top Product
- Discover our top product SPOCK3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPOCK3 Blocking Peptide, catalog no. 33R-9479, is also available for use as a blocking control in assays to test for specificity of this SPOCK3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPOCK3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))
- Andere Bezeichnung
- SPOCK3 (SPOCK3 Produkte)
- Synonyme
- im:7139568 antikoerper, si:dkey-285b22.1 antikoerper, HSAJ1454 antikoerper, TES-3 antikoerper, TICN3 antikoerper, Testican-3 antikoerper, 2900045C01Rik antikoerper, AI428471 antikoerper, mKIAA4039 antikoerper, sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 3 antikoerper, SPARC/osteonectin, cwcv and kazal like domains proteoglycan 3 antikoerper, sparc/osteonectin, cwcv and kazal-like domains proteoglycan 3 antikoerper, spock3 antikoerper, SPOCK3 antikoerper, Spock3 antikoerper
- Hintergrund
- Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding proteoglycan family .
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-