SLC12A3 Antikörper
-
- Target Alle SLC12A3 Antikörper anzeigen
- SLC12A3 (Solute Carrier Family 12 (Sodium/Chloride Transporters), Member 3 (SLC12A3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC12A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC12 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC
- Top Product
- Discover our top product SLC12A3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC12A3 Blocking Peptide, catalog no. 33R-1342, is also available for use as a blocking control in assays to test for specificity of this SLC12A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC12A3 (Solute Carrier Family 12 (Sodium/Chloride Transporters), Member 3 (SLC12A3))
- Andere Bezeichnung
- SLC12A3 (SLC12A3 Produkte)
- Synonyme
- SLC12A3 antikoerper, slc12a3 antikoerper, DKFZp469N2315 antikoerper, NCC antikoerper, NCCT antikoerper, TSC antikoerper, AI035291 antikoerper, solute carrier family 12 member 3 antikoerper, solute carrier family 12 (sodium/chloride transporter), member 3 antikoerper, solute carrier family 12, member 3 antikoerper, SLC12A3 antikoerper, slc12a3.2 antikoerper, Slc12a3 antikoerper
- Hintergrund
- This gene encodes a renal thiazide-sensitive sodium-chloride cotransporter that is important for electrolyte homeostasis. This cotransporter mediates sodium and chloride reabsorption in the distal convoluted tubule.
- Molekulargewicht
- 114 kDa (MW of target protein)
-