FNDC4 Antikörper (Middle Region)

Produktnummer ABIN635170

Produktdetails anti-FNDC4 Antikörper

Target: FNDC4 (Fibronectin Type III Domain Containing 4 (FNDC4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FNDC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FNDC4 antibody was raised against the middle region of FNDC4

Aufreinigung: Affinity purified

Immunogen: FNDC4 antibody was raised using the middle region of FNDC4 corresponding to a region with amino acids EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FNDC4 Blocking Peptide, catalog no. 33R-2440, is also available for use as a blocking control in assays to test for specificity of this FNDC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNDC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FNDC4

Target: FNDC4 (Fibronectin Type III Domain Containing 4 (FNDC4))

Andere Bezeichnung: FNDC4 (FNDC4 Produkte)

Synonyme: 2810430J06Rik antikoerper, 6330410H20Rik antikoerper, AB030187 antikoerper, AI838506 antikoerper, AW487863 antikoerper, FRCP1 antikoerper, Fnmp1 antikoerper, FNDC4 antikoerper, fibronectin type III domain containing 4 antikoerper, Fndc4 antikoerper, FNDC4 antikoerper, fndc4 antikoerper

Hintergrund: The function of Fibronectin protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 25 kDa (MW of target protein)