FNDC4 Antikörper (Middle Region)
-
- Target Alle FNDC4 Antikörper anzeigen
- FNDC4 (Fibronectin Type III Domain Containing 4 (FNDC4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FNDC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FNDC4 antibody was raised against the middle region of FNDC4
- Aufreinigung
- Affinity purified
- Immunogen
- FNDC4 antibody was raised using the middle region of FNDC4 corresponding to a region with amino acids EGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRS
- Top Product
- Discover our top product FNDC4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FNDC4 Blocking Peptide, catalog no. 33R-2440, is also available for use as a blocking control in assays to test for specificity of this FNDC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNDC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FNDC4 (Fibronectin Type III Domain Containing 4 (FNDC4))
- Andere Bezeichnung
- FNDC4 (FNDC4 Produkte)
- Synonyme
- 2810430J06Rik antikoerper, 6330410H20Rik antikoerper, AB030187 antikoerper, AI838506 antikoerper, AW487863 antikoerper, FRCP1 antikoerper, Fnmp1 antikoerper, FNDC4 antikoerper, fibronectin type III domain containing 4 antikoerper, Fndc4 antikoerper, FNDC4 antikoerper, fndc4 antikoerper
- Hintergrund
- The function of Fibronectin protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 25 kDa (MW of target protein)
-