LAX1 Antikörper (Middle Region)
-
- Target Alle LAX1 Antikörper anzeigen
- LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LAX1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LAX1 antibody was raised against the middle region of LAX1
- Aufreinigung
- Affinity purified
- Immunogen
- LAX1 antibody was raised using the middle region of LAX1 corresponding to a region with amino acids LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS
- Top Product
- Discover our top product LAX1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LAX1 Blocking Peptide, catalog no. 33R-4955, is also available for use as a blocking control in assays to test for specificity of this LAX1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAX1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))
- Andere Bezeichnung
- LAX1 (LAX1 Produkte)
- Synonyme
- LAX antikoerper, A530029E09 antikoerper, E430019B13Rik antikoerper, lymphocyte transmembrane adaptor 1 antikoerper, LAX1 antikoerper, Lax1 antikoerper
- Hintergrund
- LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response
-