LAX1 Antikörper (Middle Region)

Produktnummer ABIN635163

Der Kaninchen Polyklonal anti-LAX1 Antikörper (ABIN635163) detektiert spezifisch LAX1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für LAX1 Antikörper (Middle Region) (ABIN635163)

Target: LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LAX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LAX1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LAX1 antibody was raised against the middle region of LAX1

Aufreinigung: Affinity purified

Immunogen: LAX1 antibody was raised using the middle region of LAX1 corresponding to a region with amino acids LFVLPSTQKLEFTEERDEGCGDAGDCTSLYSPGAEDSDSLSNGEGSSQIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LAX1 Blocking Peptide, (ABIN940341), is also available for use as a blocking control in assays to test for specificity of this LAX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LAX1

Target: LAX1 (Lymphocyte Transmembrane Adaptor 1 (LAX1))

Andere Bezeichnung: LAX1

Hintergrund: LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response