ALDH3A2 Antikörper (Middle Region)
-
- Target Alle ALDH3A2 Antikörper anzeigen
- ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALDH3A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALDH3 A2 antibody was raised against the middle region of ALDH3 2
- Aufreinigung
- Affinity purified
- Immunogen
- ALDH3 A2 antibody was raised using the middle region of ALDH3 2 corresponding to a region with amino acids DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR
- Top Product
- Discover our top product ALDH3A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALDH3A2 Blocking Peptide, catalog no. 33R-1975, is also available for use as a blocking control in assays to test for specificity of this ALDH3A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))
- Andere Bezeichnung
- ALDH3A2 (ALDH3A2 Produkte)
- Synonyme
- ALDH10 antikoerper, FALDH antikoerper, SLS antikoerper, AI194803 antikoerper, Ahd-3 antikoerper, Ahd-3r antikoerper, Ahd3 antikoerper, Ahd3-r antikoerper, Aldh4 antikoerper, Aldh4-r antikoerper, ALDH-III antikoerper, CG11140 antikoerper, CT41571 antikoerper, Dhap antikoerper, Dmel\\CG11140 antikoerper, l(2)03610 antikoerper, Aldh-III antikoerper, aldh3a2 antikoerper, wu:fc06b11 antikoerper, zgc:92064 antikoerper, ALDH3A2 antikoerper, aldehyde dehydrogenase 3 family member A2 antikoerper, aldehyde dehydrogenase family 3, subfamily A2 antikoerper, aldehyde dehydrogenase 3 family, member A2 antikoerper, Aldehyde dehydrogenase type III antikoerper, fatty aldehyde dehydrogenase antikoerper, aldehyde dehydrogenase 3 family, member A2a antikoerper, aldehyde dehydrogenase 3 family member A2 S homeolog antikoerper, aldH antikoerper, ALDH3A2 antikoerper, Aldh3a2 antikoerper, Aldh-III antikoerper, PTRG_02589 antikoerper, aldh3a2 antikoerper, aldh3a2a antikoerper, aldh3a2.S antikoerper, aldH antikoerper
- Hintergrund
- Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. ALDH3A2 catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid.
- Molekulargewicht
- 58 kDa (MW of target protein)
-