Reticulon 1 Antikörper (Middle Region)
-
- Target Alle Reticulon 1 (RTN1) Antikörper anzeigen
- Reticulon 1 (RTN1)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Reticulon 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RTN1 antibody was raised against the middle region of RTN1
- Aufreinigung
- Affinity purified
- Immunogen
- RTN1 antibody was raised using the middle region of RTN1 corresponding to a region with amino acids MAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE
- Top Product
- Discover our top product RTN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RTN1 Blocking Peptide, catalog no. 33R-5805, is also available for use as a blocking control in assays to test for specificity of this RTN1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RTN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Reticulon 1 (RTN1)
- Andere Bezeichnung
- RTN1 (RTN1 Produkte)
- Synonyme
- NSP antikoerper, 0710005K15Rik antikoerper, 4930441F12Rik antikoerper, Nsp antikoerper, R75279 antikoerper, Rtn1-a antikoerper, Rtn1-b antikoerper, Rtn1-c antikoerper, reticulon-1 antikoerper, RTN1 antikoerper, RTN1-Cw antikoerper, rtn1 antikoerper, XRTN1-A antikoerper, XRTN1-C.1 antikoerper, xrtn1 antikoerper, xrtn1-c antikoerper, RTN1.2 antikoerper, Rtn1-C.2 antikoerper, rtn1-a antikoerper, rtn1b antikoerper, xRTN1 antikoerper, RTN1.1 antikoerper, rtn1a antikoerper, xrtn1-c.1 antikoerper, rtn1l antikoerper, wu:fa21b09 antikoerper, wu:fj35h01 antikoerper, reticulon 1 antikoerper, reticulon-1 antikoerper, reticulon 1 S homeolog antikoerper, reticulon 1 L homeolog antikoerper, reticulon 1b antikoerper, RTN1 antikoerper, Rtn1 antikoerper, rtn1 antikoerper, Rtnl1 antikoerper, LOC100580843 antikoerper, rtn1.S antikoerper, rtn1.L antikoerper, LOC100339591 antikoerper, rtn1b antikoerper
- Hintergrund
- Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.
- Molekulargewicht
- 23 kDa (MW of target protein)
-