SLCO1A2 Antikörper (Middle Region)

Produktnummer ABIN635140

Produktdetails anti-SLCO1A2 Antikörper

Target: SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLCO1A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLCO1 A2 antibody was raised against the middle region of SLCO1 2

Aufreinigung: Affinity purified

Immunogen: SLCO1 A2 antibody was raised using the middle region of SLCO1 2 corresponding to a region with amino acids AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLIC

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLCO1A2 Blocking Peptide, catalog no. 33R-1268, is also available for use as a blocking control in assays to test for specificity of this SLCO1A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLCO1A2

Target: SLCO1A2 (Solute Carrier Organic Anion Transporter Family, Member 1A2 (SLCO1A2))

Andere Bezeichnung: SLCO1A2 (SLCO1A2 Produkte)

Synonyme: OATP antikoerper, OATP-A antikoerper, OATP1A2 antikoerper, SLC21A3 antikoerper, Oatp2 antikoerper, Slc21a5 antikoerper, Slco1a4 antikoerper, solute carrier organic anion transporter family member 1A2 antikoerper, solute carrier organic anion transporter family, member 1A2 antikoerper, SLCO1A2 antikoerper, Slco1a2 antikoerper

Hintergrund: SLCO1A2 is a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute carriers.

Molekulargewicht: 64 kDa (MW of target protein)