SLC6A5 Antikörper
-
- Target Alle SLC6A5 Antikörper anzeigen
- SLC6A5 (Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC6A5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC6 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE
- Top Product
- Discover our top product SLC6A5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC6A5 Blocking Peptide, catalog no. 33R-5068, is also available for use as a blocking control in assays to test for specificity of this SLC6A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC6A5 (Solute Carrier Family 6 (Neurotransmitter Transporter, Glycine), Member 5 (SLC6A5))
- Andere Bezeichnung
- SLC6A5 (SLC6A5 Produkte)
- Synonyme
- SLC6A5 antikoerper, Glyt2 antikoerper, prestin antikoerper, GLYT-2 antikoerper, GLYT2 antikoerper, HKPX3 antikoerper, NET1 antikoerper, solute carrier family 6 member 5 antikoerper, solute carrier family 6 (neurotransmitter transporter, glycine), member 5 antikoerper, SLC6A5 antikoerper, Slc6a5 antikoerper
- Hintergrund
- This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission.
- Molekulargewicht
- 87 kDa (MW of target protein)
-