FAM19A4 Antikörper (Middle Region)
-
- Target Alle FAM19A4 Antikörper anzeigen
- FAM19A4 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A4 (FAM19A4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM19A4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM19 A4 antibody was raised against the middle region of FAM19 4
- Aufreinigung
- Affinity purified
- Immunogen
- FAM19 A4 antibody was raised using the middle region of FAM19 4 corresponding to a region with amino acids SSQHLRGHAGHHQIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVA
- Top Product
- Discover our top product FAM19A4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM19A4 Blocking Peptide, catalog no. 33R-8840, is also available for use as a blocking control in assays to test for specificity of this FAM19A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM19A4 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A4 (FAM19A4))
- Andere Bezeichnung
- FAM19A4 (FAM19A4 Produkte)
- Synonyme
- TAFA-4 antikoerper, TAFA4 antikoerper, C130034I18Rik antikoerper, Fam19a4 Tafa-4 antikoerper, Tafa-4 antikoerper, family with sequence similarity 19 member A4, C-C motif chemokine like antikoerper, family with sequence similarity 19, member A4 antikoerper, FAM19A4 antikoerper, Fam19a4 antikoerper
- Hintergrund
- This gene is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Transcript variants with different 5' UTRs, but encoding the same protein, have been found for this gene.
- Molekulargewicht
- 16 kDa (MW of target protein)
-