SLCO1C1 Antikörper (N-Term)

Produktnummer ABIN635126

Produktdetails anti-SLCO1C1 Antikörper

Target: SLCO1C1 (Solute Carrier Organic Anion Transporter Family, Member 1C1 (SLCO1C1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLCO1C1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLCO1 C1 antibody was raised against the N terminal of SLCO1 1

Aufreinigung: Affinity purified

Immunogen: SLCO1 C1 antibody was raised using the N terminal of SLCO1 1 corresponding to a region with amino acids VDTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLCO1C1 Blocking Peptide, catalog no. 33R-9482, is also available for use as a blocking control in assays to test for specificity of this SLCO1C1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-SLCO1C1 Antikörper (ABIN635126)

Szczupak, Peña, Bracho, Mei, Bas, Fernandez-Valle, Liu, Telischi, Ivan, Dinh: "Fluorescent Detection of Vestibular Schwannoma Using Intravenous Sodium Fluorescein In Vivo." in: Otology & neurotology : official publication of the American Otological Society, American Neurotology Society [and] European Academy of Otology and Neurotology, Vol. 42, Issue 4, pp. e503-e511, (2021) (PubMed).

Details zu SLCO1C1

Target: SLCO1C1 (Solute Carrier Organic Anion Transporter Family, Member 1C1 (SLCO1C1))

Andere Bezeichnung: SLCO1C1 (SLCO1C1 Produkte)

Synonyme: OATP-F antikoerper, OATP1 antikoerper, OATP14 antikoerper, OATP1C1 antikoerper, OATPF antikoerper, OATPRP5 antikoerper, SLC21A14 antikoerper, OATP-14 antikoerper, Oatp2 antikoerper, Oatpf antikoerper, Slc21a14 antikoerper, Bsat1 antikoerper, Oatp14 antikoerper, solute carrier organic anion transporter family member 1C1 antikoerper, solute carrier organic anion transporter family, member 1c1 antikoerper, SLCO1C1 antikoerper, Slco1c1 antikoerper

Hintergrund: SLCO1C1 is a member of the organic anion transporter family. SLCO1C1 is a transmembrane receptor that mediates the sodium-independent uptake of thyroid hormones in brain tissues. This protein has particularly high affinity for the thyroid hormones thyroxine, tri-iodothyronine and reverse tri-iodothyronine. Polymorphisms in the gene encoding this protein may be associated with fatigue and depression in patients suffering from hyperthyroidism.

Molekulargewicht: 79 kDa (MW of target protein)