RNF121 Antikörper (Middle Region)
-
- Target Alle RNF121 Antikörper anzeigen
- RNF121 (Ring Finger Protein 121 (RNF121))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF121 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RNF121 antibody was raised against the middle region of RNF121
- Aufreinigung
- Affinity purified
- Immunogen
- RNF121 antibody was raised using the middle region of RNF121 corresponding to a region with amino acids GMPTKHLSDSVCAVCGQQIFVDVSEEGIIENTYRLSCNHVFHEFCIRGWC
- Top Product
- Discover our top product RNF121 Primärantikörper
-
anti-Ring Finger Protein 121 (RNF121) (AA 193-301) antibody
RNF121 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2G7 unconjugated
anti-Ring Finger Protein 121 (RNF121) (AA 101-150) antibodyRNF121 Reaktivität: Human, Ratte, Maus, Hund, Rind (Kuh), Kaninchen, Meerschweinchen, Pferd, Affe, Fledermaus, Schwein WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Ring Finger Protein 121 (RNF121) (AA 193-301) antibodyRNF121 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Ring Finger Protein 121 (RNF121) (AA 215-264) antibodyRNF121 Reaktivität: Human, Ratte, Hund, Rind (Kuh), Kaninchen, Meerschweinchen, Pferd, Affe, Fledermaus, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ring Finger Protein 121 (RNF121) (N-Term) antibodyRNF121 Reaktivität: Human, Ratte, Maus, Hund, Rind (Kuh), Kaninchen, Meerschweinchen, Pferd, Zebrafisch (Danio rerio) WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Ring Finger Protein 121 (RNF121) (Middle Region) antibodyRNF121 Reaktivität: Human, Ratte, Maus, Hund, Rind (Kuh), Kaninchen, Meerschweinchen, Pferd, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Ring Finger Protein 121 (RNF121) antibodyRNF121 Reaktivität: Human, Ratte, Maus, Hund WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNF121 Blocking Peptide, catalog no. 33R-3438, is also available for use as a blocking control in assays to test for specificity of this RNF121 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF121 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF121 (Ring Finger Protein 121 (RNF121))
- Andere Bezeichnung
- RNF121 (RNF121 Produkte)
- Synonyme
- 4930544L10Rik antikoerper, im:6907121 antikoerper, si:ch73-373k7.1 antikoerper, ring finger protein 121 antikoerper, RING finger protein 121 antikoerper, RNF121 antikoerper, rnf-121 antikoerper, Rnf121 antikoerper, rnf121 antikoerper
- Hintergrund
- The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. Three of them are supported by at least two independent transcripts or ESTs, the full length natures of others are not clear.
- Molekulargewicht
- 38 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-
