ANO3 Antikörper (Middle Region)
-
- Target Alle ANO3 Antikörper anzeigen
- ANO3 (Anoctamin 3 (ANO3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ANO3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM16 C antibody was raised against the middle region of TMEM16
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM16 C antibody was raised using the middle region of TMEM16 corresponding to a region with amino acids WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIF
- Top Product
- Discover our top product ANO3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM16C Blocking Peptide, catalog no. 33R-10041, is also available for use as a blocking control in assays to test for specificity of this TMEM16C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANO3 (Anoctamin 3 (ANO3))
- Andere Bezeichnung
- TMEM16C (ANO3 Produkte)
- Synonyme
- TMEM16C antikoerper, anoctamin-3 antikoerper, C11orf25 antikoerper, DYT23 antikoerper, DYT24 antikoerper, AI838058 antikoerper, B230324K02Rik antikoerper, Tmem16c antikoerper, anoctamin 3 antikoerper, anoctamin-3 antikoerper, ANO3 antikoerper, LOC100453980 antikoerper, ano3 antikoerper, Ano3 antikoerper
- Hintergrund
- TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.
- Molekulargewicht
- 115 kDa (MW of target protein)
-