SLC1A2 Antikörper

Produktnummer ABIN635116

Produktdetails anti-SLC1A2 Antikörper

Target: SLC1A2 (Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC1A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC1 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC1A2 Blocking Peptide, catalog no. 33R-5500, is also available for use as a blocking control in assays to test for specificity of this SLC1A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC1A2

Target: SLC1A2 (Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2))

Andere Bezeichnung: SLC1A2 (SLC1A2 Produkte)

Synonyme: CG3159 antikoerper, Dmel\\CG3159 antikoerper, EAAT antikoerper, dEAAT2 antikoerper, dEaat2 antikoerper, Eaat antikoerper, GB16377 antikoerper, EAAT2 antikoerper, SLC1A2 antikoerper, Eaat2 antikoerper, Glt antikoerper, Glt-1 antikoerper, GLT-1 antikoerper, 1700091C19Rik antikoerper, 2900019G14Rik antikoerper, AI159670 antikoerper, GLT1 antikoerper, MGLT1 antikoerper, eaat2 antikoerper, fj34b12 antikoerper, slc1a2 antikoerper, wu:fj34b12 antikoerper, zgc:65897 antikoerper, Excitatory amino acid transporter 2 antikoerper, excitatory amino acid transporter 2 antikoerper, solute carrier family 1 member 2 antikoerper, solute carrier family 1 (glial high affinity glutamate transporter), member 2 antikoerper, solute carrier family 1 (glial high affinity glutamate transporter), member 2b antikoerper, Eaat2 antikoerper, Eaat-2 antikoerper, SLC1A2 antikoerper, VDBG_06180 antikoerper, EUBELI_01747 antikoerper, Trebr_0139 antikoerper, Slc1a2 antikoerper, slc1a2b antikoerper

Hintergrund: SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport