LRRC8B Antikörper (Middle Region)
-
- Target Alle LRRC8B Antikörper anzeigen
- LRRC8B (Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRRC8B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRRC8 B antibody was raised against the middle region of LRRC8
- Aufreinigung
- Affinity purified
- Immunogen
- LRRC8 B antibody was raised using the middle region of LRRC8 corresponding to a region with amino acids TLYLKSSLSRIPQVVTDLLPSLQKLSLDNEGSKLVVLNNLKKMVNLKSLE
- Top Product
- Discover our top product LRRC8B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRRC8B Blocking Peptide, catalog no. 33R-9195, is also available for use as a blocking control in assays to test for specificity of this LRRC8B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC8B (Leucine Rich Repeat Containing 8 Family, Member B (LRRC8B))
- Andere Bezeichnung
- LRRC8B (LRRC8B Produkte)
- Synonyme
- TA-LRRP antikoerper, TALRRP antikoerper, R75581 antikoerper, Ta-lrrp antikoerper, mKIAA0231 antikoerper, RGD1563429 antikoerper, leucine rich repeat containing 8 family member B antikoerper, leucine rich repeat containing 8 VRAC subunit B S homeolog antikoerper, leucine rich repeat containing 8 VRAC subunit B antikoerper, leucine rich repeat containing 8 family, member B antikoerper, LRRC8B antikoerper, lrrc8b.S antikoerper, lrrc8b antikoerper, Lrrc8b antikoerper
- Hintergrund
- The function of LRRC8B protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 92 kDa (MW of target protein)
-