PTGER3 Antikörper

Produktnummer ABIN635100

Produktdetails anti-PTGER3 Antikörper

Target: PTGER3 (Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTGER3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PTGER3 antibody was raised using a synthetic peptide corresponding to a region with amino acids STVIDPSRFCAQPFRWFLDLSFPAMSSSHPQLPLTLASFKLLREPCSVQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTGER3 Blocking Peptide, catalog no. 33R-8894, is also available for use as a blocking control in assays to test for specificity of this PTGER3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTGER3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTGER3

Target: PTGER3 (Prostaglandin E Receptor 3 (Subtype EP3) (PTGER3))

Andere Bezeichnung: PTGER3 (PTGER3 Produkte)

Synonyme: PTGER3 antikoerper, EP3 antikoerper, EP3-I antikoerper, EP3-II antikoerper, EP3-III antikoerper, EP3-IV antikoerper, EP3e antikoerper, PGE2-R antikoerper, PTGEREP3 antikoerper, Rep3 antikoerper, rEP3a antikoerper, rEP3b antikoerper, Pgerep3 antikoerper, Ptgerep3 antikoerper, prostaglandin E receptor 3 antikoerper, prostaglandin E receptor 3 L homeolog antikoerper, prostaglandin E receptor 3 (subtype EP3) antikoerper, PTGER3 antikoerper, ptger3.L antikoerper, Ptger3 antikoerper

Hintergrund: PTGER3 is the receptor for prostaglandin E2 (PGE2), the EP3 receptor may be involved in inhibition of gastric acid secretion, modulation of neurotransmitter release in central and peripheral neurons, inhibition of sodium and water reabsorption in kidney tubulus and contraction in uterine smooth muscle. The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G-I proteins, and to an elevation of intracellular calcium. The various isoforms have identical ligand binding properties but can interact with different second messenger systems.

Molekulargewicht: 47 kDa (MW of target protein)