SLC25A34 Antikörper (Middle Region)
-
- Target Alle SLC25A34 Antikörper anzeigen
- SLC25A34 (Solute Carrier Family 25, Member 34 (SLC25A34))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A34 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC25 A34 antibody was raised against the middle region of SLC25 34
- Aufreinigung
- Affinity purified
- Immunogen
- SLC25 A34 antibody was raised using the middle region of SLC25 34 corresponding to a region with amino acids TDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQH
- Top Product
- Discover our top product SLC25A34 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A34 Blocking Peptide, catalog no. 33R-9006, is also available for use as a blocking control in assays to test for specificity of this SLC25A34 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 34 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A34 (Solute Carrier Family 25, Member 34 (SLC25A34))
- Andere Bezeichnung
- SLC25A34 (SLC25A34 Produkte)
- Synonyme
- slc25a34 antikoerper, zgc:77445 antikoerper, RP11-169K16.2 antikoerper, Gm1369 antikoerper, solute carrier family 25, member 34 antikoerper, solute carrier family 25 member 34 antikoerper, slc25a34 antikoerper, SLC25A34 antikoerper, Slc25a34 antikoerper
- Hintergrund
- SLC25A35 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. It is a multi-pass membrane protein. The functions of SLC25A35 remain unknown.SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins.
- Molekulargewicht
- 32 kDa (MW of target protein)
-