Slc25a1 Antikörper
-
- Target Alle Slc25a1 Antikörper anzeigen
- Slc25a1 (Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Slc25a1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC25 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGL
- Top Product
- Discover our top product Slc25a1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A1 Blocking Peptide, catalog no. 33R-6746, is also available for use as a blocking control in assays to test for specificity of this SLC25A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Slc25a1 (Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1))
- Andere Bezeichnung
- SLC25A1 (Slc25a1 Produkte)
- Synonyme
- MGC53598 antikoerper, slc25a1 antikoerper, zgc:63578 antikoerper, ctp antikoerper, slc20a3 antikoerper, CG31305 antikoerper, CG6782 antikoerper, DmCIC antikoerper, Dmel\\CG6782 antikoerper, SLC25A1 antikoerper, anon-WO0140519.12 antikoerper, l(3)EP3364 antikoerper, NV14384 antikoerper, 1300019P08Rik antikoerper, 2610100G11Rik antikoerper, AI194714 antikoerper, Ctp antikoerper, Dgsj antikoerper, Slc20a3 antikoerper, Cic antikoerper, CTP antikoerper, D2L2AD antikoerper, SEA antikoerper, SLC20A3 antikoerper, solute carrier family 25 member 1 L homeolog antikoerper, solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1a antikoerper, solute carrier family 25 member 1 antikoerper, scheggia antikoerper, solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1 antikoerper, solute carrier family 25 (mitochondrial carrier, citrate transporter), member 1 antikoerper, slc25a1.L antikoerper, slc25a1a antikoerper, slc25a1 antikoerper, SLC25A1 antikoerper, sea antikoerper, Slc25a1 antikoerper
- Hintergrund
- The mitochondrial tricarboxylate transporter (also called citrate transport protein, or CTP) is responsible for the movement of citrate across the mitochondrial inner membrane.
- Molekulargewicht
- 34 kDa (MW of target protein)
-