SLC25A4 Antikörper
-
- Target Alle SLC25A4 Antikörper anzeigen
- SLC25A4 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC25 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
- Top Product
- Discover our top product SLC25A4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A4 Blocking Peptide, catalog no. 33R-5186, is also available for use as a blocking control in assays to test for specificity of this SLC25A4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A4 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4))
- Andere Bezeichnung
- SLC25A4 (SLC25A4 Produkte)
- Synonyme
- 1 antikoerper, AAC1 antikoerper, ANT antikoerper, ANT 1 antikoerper, ANT1 antikoerper, PEO2 antikoerper, PEO3 antikoerper, T1 antikoerper, AU019225 antikoerper, Ant1 antikoerper, ant antikoerper, ant1 antikoerper, peo2 antikoerper, peo3 antikoerper, MANT1 antikoerper, SLC25A5 antikoerper, fa22e07 antikoerper, wu:fa22e07 antikoerper, zgc:77591 antikoerper, slc25a4 antikoerper, solute carrier family 25 member 4 antikoerper, solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 4 antikoerper, adenine nucleotide translocator antikoerper, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 antikoerper, solute carrier family 25 member 4 L homeolog antikoerper, SLC25A4 antikoerper, Slc25a4 antikoerper, slc25a4 antikoerper, ANT1 antikoerper, slc25a4.L antikoerper
- Hintergrund
- This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.
- Molekulargewicht
- 33 kDa (MW of target protein)
- Pathways
- Proton Transport, Dicarboxylic Acid Transport
-