SLC25A16 Antikörper
-
- Target Alle SLC25A16 Antikörper anzeigen
- SLC25A16 (Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC25 A16 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRR
- Top Product
- Discover our top product SLC25A16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A16 Blocking Peptide, catalog no. 33R-5430, is also available for use as a blocking control in assays to test for specificity of this SLC25A16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A16 (Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16))
- Andere Bezeichnung
- SLC25A16 (SLC25A16 Produkte)
- Synonyme
- gda antikoerper, gdc antikoerper, ml7 antikoerper, hml7 antikoerper, hgt.1 antikoerper, d10s105e antikoerper, 3110021G18Rik antikoerper, GDA antikoerper, GDC antikoerper, HGT.1 antikoerper, ML7 antikoerper, D10S105E antikoerper, hML7 antikoerper, wu:fc33c08 antikoerper, zgc:56187 antikoerper, zgc:77742 antikoerper, solute carrier family 25 member 16 antikoerper, solute carrier family 25 (mitochondrial carrier, Graves disease autoantigen), member 16 antikoerper, solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 antikoerper, SLC25A16 antikoerper, slc25a16 antikoerper, Slc25a16 antikoerper
- Hintergrund
- SLC25A16 is a protein that contains three tandemly repeated mitochondrial carrier protein domains. The protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. SLC25A16 gene has a possible role in Graves' disease.
- Molekulargewicht
- 36 kDa (MW of target protein)
-