SLC25A6 Antikörper
-
- Target Alle SLC25A6 Antikörper anzeigen
- SLC25A6 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 6 (SLC25A6))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC25A6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC25 A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ
- Top Product
- Discover our top product SLC25A6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC25A6 Blocking Peptide, catalog no. 33R-5346, is also available for use as a blocking control in assays to test for specificity of this SLC25A6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A6 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 6 (SLC25A6))
- Andere Bezeichnung
- SLC25A6 (SLC25A6 Produkte)
- Synonyme
- 2 antikoerper, 3 antikoerper, AAC3 antikoerper, ANT antikoerper, ANT 2 antikoerper, ANT 3 antikoerper, ANT3 antikoerper, ANT3Y antikoerper, SLC25A5 antikoerper, RGD1560896 antikoerper, wu:fj78b08 antikoerper, si:dkey-21o13.4 antikoerper, SLC25A6 antikoerper, solute carrier family 25 member 6 antikoerper, solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6 antikoerper, SLC25A6 antikoerper, Slc25a6 antikoerper, slc25a6 antikoerper
- Hintergrund
- SLC25A6 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. SLC25A6 may participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.
- Molekulargewicht
- 33 kDa (MW of target protein)
-