ARV1 Antikörper
-
- Target Alle ARV1 Antikörper anzeigen
- ARV1 (ARV1 Homolog (ARV1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ARV1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ARV1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD
- Top Product
- Discover our top product ARV1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ARV1 Blocking Peptide, catalog no. 33R-7461, is also available for use as a blocking control in assays to test for specificity of this ARV1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARV1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARV1 (ARV1 Homolog (ARV1))
- Andere Bezeichnung
- ARV1 (ARV1 Produkte)
- Synonyme
- 1110067L22Rik antikoerper, AI461928 antikoerper, AW121084 antikoerper, ARV1 homolog, fatty acid homeostasis modulator antikoerper, ARV1 antikoerper, Arv1 antikoerper
- Hintergrund
- ARV1 may act as a mediator of sterol homeostasis.
- Molekulargewicht
- 31 kDa (MW of target protein)
-