-
- Target Alle CUTA Antikörper anzeigen
- CUTA (Protein CutA (CUTA))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CUTA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- CUTA antibody was raised using a synthetic peptide corresponding to a region with amino acids AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL
- Top Product
- Discover our top product CUTA Primärantikörper
-
anti-Protein CutA (CUTA) (AA 33-150) antibody
CUTA Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Protein CutA (CUTA) (C-Term) antibodyVerified CUTA Reaktivität: Human WB, ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-Protein CutA (CUTA) (AA 71-120) antibodyCUTA Reaktivität: Human, Maus, Ratte, Rind (Kuh), Kaninchen, Hund, Meerschweinchen, Pferd, Schwein, Fledermaus, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Protein CutA (CUTA) (AA 116-144), (C-Term) antibodyCUTA Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB42878 unconjugated
anti-Protein CutA (CUTA) antibodyCUTA Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Protein CutA (CUTA) (AA 33-179) antibodyCUTA Reaktivität: Human WB, IHC, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CUTA Blocking Peptide, catalog no. 33R-1183, is also available for use as a blocking control in assays to test for specificity of this CUTA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUTA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CUTA (Protein CutA (CUTA))
- Andere Bezeichnung
- CUTA (CUTA Produkte)
- Synonyme
- ACHAP antikoerper, C6orf82 antikoerper, 0610039D01Rik antikoerper, 1810022E02Rik antikoerper, 1810060C03Rik antikoerper, 2700094G22Rik antikoerper, AI326454 antikoerper, CutA1 antikoerper, cutA divalent cation tolerance homolog antikoerper, CUTA antikoerper, Cuta antikoerper
- Hintergrund
- CUTA may forms part of a complex of membrane proteins attached to acetylcholinesterase (AChE).
- Molekulargewicht
- 19 kDa (MW of target protein)
-
Sie sind hier:
