LY6G6F Antikörper (Middle Region)

Produktnummer ABIN634984

Produktdetails anti-LY6G6F Antikörper

Target: LY6G6F (Lymphocyte Antigen 6 Complex, Locus G6F (LY6G6F))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LY6G6F Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C6 ORF21 antibody was raised against the middle region of C6 rf21

Aufreinigung: Affinity purified

Immunogen: C6 ORF21 antibody was raised using the middle region of C6 rf21 corresponding to a region with amino acids LLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C6ORF21 Blocking Peptide, catalog no. 33R-5121, is also available for use as a blocking control in assays to test for specificity of this C6ORF21 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF21 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LY6G6F

Target: LY6G6F (Lymphocyte Antigen 6 Complex, Locus G6F (LY6G6F))

Andere Bezeichnung: C6ORF21 (LY6G6F Produkte)

Synonyme: C6orf21 antikoerper, G6f antikoerper, LY6G6D antikoerper, NG32 antikoerper, CJ068215 antikoerper, C6ORF21 antikoerper, lymphocyte antigen 6 family member G6F antikoerper, lymphocyte antigen 6 complex, locus G6F antikoerper, LY6G6F antikoerper, Ly6g6f antikoerper

Hintergrund: The human G6f protein(C6orf21) is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition.It may also play a role in the downstream signal transduction pathways involving GRB2 and GRB7.

Molekulargewicht: 31 kDa (MW of target protein)