SEMA3D Antikörper (Middle Region)
-
- Target Alle SEMA3D Antikörper anzeigen
- SEMA3D (Sema Domain, Immunoglobulin Domain (Ig), Short Basic Domain, Secreted, (Semaphorin) 3D (SEMA3D))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SEMA3D Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SEMA3 D antibody was raised against the middle region of SEMA3
- Aufreinigung
- Affinity purified
- Immunogen
- SEMA3 D antibody was raised using the middle region of SEMA3 corresponding to a region with amino acids LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
- Top Product
- Discover our top product SEMA3D Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SEMA3D Blocking Peptide, catalog no. 33R-4883, is also available for use as a blocking control in assays to test for specificity of this SEMA3D antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEMA3D (Sema Domain, Immunoglobulin Domain (Ig), Short Basic Domain, Secreted, (Semaphorin) 3D (SEMA3D))
- Andere Bezeichnung
- SEMA3D (SEMA3D Produkte)
- Synonyme
- MGC82143 antikoerper, Sema-Z2 antikoerper, coll-2 antikoerper, 4631426B19Rik antikoerper, sema2 antikoerper, semaZ2 antikoerper, semaphorin 3D S homeolog antikoerper, semaphorin 3D antikoerper, sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D antikoerper, sema3d.S antikoerper, SEMA3D antikoerper, sema3d antikoerper, Sema3d antikoerper
- Hintergrund
- SEMA3D induces the collapse and paralysis of neuronal growth cones. SEMA3D could potentially act as repulsive cues toward specific neuronal populations.
- Molekulargewicht
- 90 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-