IGSF11 Antikörper (Middle Region)

Produktnummer ABIN634976

Produktdetails anti-IGSF11 Antikörper

Target: IGSF11 (Immunoglobulin Superfamily, Member 11 (IGSF11))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGSF11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IGSF11 antibody was raised against the middle region of IGSF11

Aufreinigung: Affinity purified

Immunogen: IGSF11 antibody was raised using the middle region of IGSF11 corresponding to a region with amino acids EKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IGSF11 Blocking Peptide, catalog no. 33R-2510, is also available for use as a blocking control in assays to test for specificity of this IGSF11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGSF11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGSF11

Target: IGSF11 (Immunoglobulin Superfamily, Member 11 (IGSF11))

Andere Bezeichnung: IGSF11 (IGSF11 Produkte)

Synonyme: sc:d812 antikoerper, seurat antikoerper, BT-IgSF antikoerper, CT119 antikoerper, CXADRL1 antikoerper, Igsf13 antikoerper, VSIG3 antikoerper, 1700025L02Rik antikoerper, immunoglobulin superfamily member 11 antikoerper, immunoglobulin superfamily member 11 L homeolog antikoerper, immunoglobulin superfamily, member 11 antikoerper, IGSF11 antikoerper, igsf11 antikoerper, igsf11.L antikoerper, Igsf11 antikoerper

Hintergrund: IGSF11 functions as a cell adhesion molecule through homophilic interaction. IGSF11 stimulates cell growth.IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor and endothelial cell-selective adhesion molecule.

Molekulargewicht: 46 kDa (MW of target protein)