ATP2B4 Antikörper (Middle Region)

Produktnummer ABIN634952

Produktdetails anti-ATP2B4 Antikörper

Target: ATP2B4 (ATPase, Ca++ Transporting, Plasma Membrane 4 (ATP2B4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP2B4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP2 B4 antibody was raised against the middle region of ATP2 4

Aufreinigung: Affinity purified

Immunogen: ATP2 B4 antibody was raised using the middle region of ATP2 4 corresponding to a region with amino acids FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP2B4 Blocking Peptide, catalog no. 33R-2841, is also available for use as a blocking control in assays to test for specificity of this ATP2B4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP2B4

Target: ATP2B4 (ATPase, Ca++ Transporting, Plasma Membrane 4 (ATP2B4))

Andere Bezeichnung: ATP2B4 (ATP2B4 Produkte)

Synonyme: ATP2B2 antikoerper, MXRA1 antikoerper, PMCA4 antikoerper, PMCA4b antikoerper, PMCA4x antikoerper, atp2b2 antikoerper, atp2b3 antikoerper, mxra1 antikoerper, pmca4 antikoerper, pmca4b antikoerper, pmca4x antikoerper, zgc:152801 antikoerper, ATP2B4 antikoerper, ATP2B1 antikoerper, Pmca4 antikoerper, ATPase plasma membrane Ca2+ transporting 4 antikoerper, ATPase, Ca++ transporting, plasma membrane 4 L homeolog antikoerper, ATPase, Ca++ transporting, plasma membrane 4 antikoerper, ATP2B4 antikoerper, atp2b4.L antikoerper, atp2b4 antikoerper, Atp2b4 antikoerper

Hintergrund: ATP2B4 belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis.

Molekulargewicht: 129 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process