B3GALNT1 Antikörper
-
- Target Alle B3GALNT1 Antikörper anzeigen
- B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser B3GALNT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- B3 GALNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
- Top Product
- Discover our top product B3GALNT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
B3GALNT1 Blocking Peptide, catalog no. 33R-7328, is also available for use as a blocking control in assays to test for specificity of this B3GALNT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))
- Andere Bezeichnung
- B3GALNT1 (B3GALNT1 Produkte)
- Synonyme
- B3GALT3 antikoerper, B3galt3 antikoerper, b3GT3 antikoerper, GLCT3 antikoerper, GLOB antikoerper, Gb4Cer antikoerper, P antikoerper, P1 antikoerper, beta3Gal-T3 antikoerper, galT3 antikoerper, beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group) antikoerper, beta-1,3-N-acetylgalactosaminyltransferase 1 antikoerper, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 1 antikoerper, B3GALNT1 antikoerper, B3galnt1 antikoerper
- Hintergrund
- This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates.
- Molekulargewicht
- 39 kDa (MW of target protein)
-