DNAJB12 Antikörper
-
- Target Alle DNAJB12 Antikörper anzeigen
- DNAJB12 (DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNAJB12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DNAJB12 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILILILVSALSQLMVSSPPYSLSPRPSVGHIHRRVTDHLGVVYYVGDTFS
- Top Product
- Discover our top product DNAJB12 Primärantikörper
-
anti-DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (AA 10-119) antibody
DNAJB12 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (Center) antibodyDNAJB12 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (AA 26-130) antibodyDNAJB12 Reaktivität: Human ELISA, IF (cc), IF (p), IHC (p), IHC (fro), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (AA 7-36), (N-Term) antibodyDNAJB12 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB32908 unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) antibodyDNAJB12 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (AA 250-409) antibodyDNAJB12 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (AA 51-100) antibodyDNAJB12 Reaktivität: Maus, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (AA 51-100) antibodyDNAJB12 Reaktivität: Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (AA 287-336) antibodyDNAJB12 Reaktivität: Human, Maus, Ratte, Pferd, Hund, Zebrafisch (Danio rerio), Ziege, Meerschweinchen, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12) (Middle Region) antibodyDNAJB12 Reaktivität: Human, Maus, Ratte, Pferd, Hund, Zebrafisch (Danio rerio), Ziege, Meerschweinchen, Rind (Kuh), Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNAJB12 Blocking Peptide, catalog no. 33R-4048, is also available for use as a blocking control in assays to test for specificity of this DNAJB12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJB12 (DnaJ (Hsp40) Homolog, Subfamily B, Member 12 (DNAJB12))
- Andere Bezeichnung
- DNAJB12 (DNAJB12 Produkte)
- Synonyme
- dnajb12 antikoerper, wu:fc16f06 antikoerper, wu:fi38b10 antikoerper, MGC82876 antikoerper, DNAJB12 antikoerper, DJ10 antikoerper, Dj10 antikoerper, mDj10 antikoerper, DnaJ (Hsp40) homolog, subfamily B, member 12a antikoerper, DnaJ heat shock protein family (Hsp40) member B12 antikoerper, DnaJ heat shock protein family (Hsp40) member B12 S homeolog antikoerper, dnajb12a antikoerper, DNAJB12 antikoerper, dnajb12.S antikoerper, dnajb12 antikoerper, Dnajb12 antikoerper
- Hintergrund
- DNAJB12 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity.
- Molekulargewicht
- 42 kDa (MW of target protein)
-
