TSPAN4 Antikörper (Middle Region)

Produktnummer ABIN634910

Der Kaninchen Polyklonal anti-TSPAN4 Antikörper wird verwendet zum Nachweis von TSPAN4 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für TSPAN4 Antikörper (Middle Region) (ABIN634910)

Target: TSPAN4 (Tetraspanin 4 (TSPAN4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPAN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TSPAN4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Tetraspanin 4 antibody was raised against the middle region of TSPAN4

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 4 antibody was raised using the middle region of TSPAN4 corresponding to a region with amino acids YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 4 Blocking Peptide, (ABIN936235), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPAN4

Target: TSPAN4 (Tetraspanin 4 (TSPAN4))

Andere Bezeichnung: Tetraspanin 4

Hintergrund: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molekulargewicht: 26 kDa (MW of target protein)