TSPAN4 Antikörper (Middle Region)

Produktnummer ABIN634910

Produktdetails anti-TSPAN4 Antikörper

Target: TSPAN4 (Tetraspanin 4 (TSPAN4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSPAN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Tetraspanin 4 antibody was raised against the middle region of TSPAN4

Aufreinigung: Affinity purified

Immunogen: Tetraspanin 4 antibody was raised using the middle region of TSPAN4 corresponding to a region with amino acids YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Tetraspanin 4 Blocking Peptide, catalog no. 33R-10258, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSPAN4

Target: TSPAN4 (Tetraspanin 4 (TSPAN4))

Andere Bezeichnung: Tetraspanin 4 (TSPAN4 Produkte)

Synonyme: tspan-4 antikoerper, DKFZp469K0233 antikoerper, NAG-2 antikoerper, NAG2 antikoerper, TETRASPAN antikoerper, TM4SF7 antikoerper, TSPAN-4 antikoerper, AI325509 antikoerper, AI746565 antikoerper, D130042I01Rik antikoerper, Tm4sf7 antikoerper, Tspan-4 antikoerper, tetraspanin 4 antikoerper, tetraspanin 4 S homeolog antikoerper, uncharacterized LOC724310 antikoerper, TSPAN4 antikoerper, tspan4.S antikoerper, tspan4 antikoerper, LOC724310 antikoerper, Tspan4 antikoerper

Hintergrund: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molekulargewicht: 26 kDa (MW of target protein)