TGFB2 Antikörper (Middle Region)

Produktnummer ABIN634909

Produktdetails anti-TGFB2 Antikörper

Target: TGFB2 (Transforming Growth Factor, beta 2 (TGFB2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TGFB2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TGF beta 2 antibody was raised against the middle region of TGFB2

Aufreinigung: Affinity purified

Immunogen: TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TGF beta 2 Blocking Peptide, catalog no. 33R-6785, is also available for use as a blocking control in assays to test for specificity of this TGF beta 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFB2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TGFB2

Target: TGFB2 (Transforming Growth Factor, beta 2 (TGFB2))

Andere Bezeichnung: TGF beta 2 (TGFB2 Produkte)

Synonyme: LDS4 antikoerper, TGF-beta2 antikoerper, tgf-beta2 antikoerper, tgfb2-A antikoerper, BB105277 antikoerper, Tgf-beta2 antikoerper, Tgfb-2 antikoerper, TGF-beta 2 antikoerper, Tgfbr2T antikoerper, TGFB2 antikoerper, TGFbeta2 antikoerper, MGF antikoerper, TGF-B2 antikoerper, transforming growth factor beta 2 antikoerper, transforming growth factor beta 2 L homeolog antikoerper, transforming growth factor, beta 2 antikoerper, transforming growth factor, beta receptor 2 antikoerper, TGFB2 antikoerper, tgfb2.L antikoerper, Tgfb2 antikoerper, Tgfbr2 antikoerper, tgfb2 antikoerper

Hintergrund: This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types by transducing their signal through combinations of transmembrane type I and type II receptors (TGFBR1 and TGFBR2) and their downstream effectors, the SMAD proteins. Disruption of the TGFB/SMAD pathway has been implicated in a variety of human cancers.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Production of Molecular Mediator of Immune Response, Protein targeting to Nucleus