LAPTM4B Antikörper (Middle Region)

Produktnummer ABIN634891

Produktdetails anti-LAPTM4B Antikörper

Target: LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LAPTM4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LAPTM4 B antibody was raised against the middle region of LAPTM4

Aufreinigung: Affinity purified

Immunogen: LAPTM4 B antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LAPTM4B Blocking Peptide, catalog no. 33R-10204, is also available for use as a blocking control in assays to test for specificity of this LAPTM4B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LAPTM4B

Target: LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))

Andere Bezeichnung: LAPTM4B (LAPTM4B Produkte)

Synonyme: LAPTM4beta antikoerper, LC27 antikoerper, C330023P13Rik antikoerper, lysosomal protein transmembrane 4 beta antikoerper, lysosomal-associated protein transmembrane 4B antikoerper, LAPTM4B antikoerper, Laptm4b antikoerper

Hintergrund: LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.

Molekulargewicht: 35 kDa (MW of target protein)