ACMSD Antikörper (Middle Region)
-
- Target Alle ACMSD Antikörper anzeigen
- ACMSD (Aminocarboxymuconate Semialdehyde Decarboxylase (ACMSD))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACMSD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACMSD antibody was raised against the middle region of ACMSD
- Aufreinigung
- Affinity purified
- Immunogen
- ACMSD antibody was raised using the middle region of ACMSD corresponding to a region with amino acids NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE
- Top Product
- Discover our top product ACMSD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACMSD Blocking Peptide, catalog no. 33R-6822, is also available for use as a blocking control in assays to test for specificity of this ACMSD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACMSD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACMSD (Aminocarboxymuconate Semialdehyde Decarboxylase (ACMSD))
- Andere Bezeichnung
- ACMSD (ACMSD Produkte)
- Synonyme
- zgc:162888 antikoerper, ACMSD antikoerper, aminocarboxymuconate semialdehyde decarboxylase antikoerper, aminocarboxymuconate semialdehyde decarboxylase S homeolog antikoerper, amino carboxymuconate semialdehyde decarboxylase antikoerper, ACMSD antikoerper, acmsd antikoerper, acmsd.S antikoerper, Acmsd antikoerper
- Hintergrund
- The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders.
- Molekulargewicht
- 38 kDa (MW of target protein)
-