ACMSD Antikörper (Middle Region)

Produktnummer ABIN634884

Der Kaninchen Polyklonal anti-ACMSD Antikörper (ABIN634884) detektiert spezifisch ACMSD in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ACMSD Antikörper (Middle Region) (ABIN634884)

Target: ACMSD (Aminocarboxymuconate Semialdehyde Decarboxylase (ACMSD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACMSD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACMSD Antikörper

Bindungsspezifität: Middle Region

Spezifität: ACMSD antibody was raised against the middle region of ACMSD

Aufreinigung: Affinity purified

Immunogen: ACMSD antibody was raised using the middle region of ACMSD corresponding to a region with amino acids NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACMSD Blocking Peptide, (ABIN5611902), is also available for use as a blocking control in assays to test for specificity of this ACMSD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACMSD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACMSD

Target: ACMSD (Aminocarboxymuconate Semialdehyde Decarboxylase (ACMSD))

Andere Bezeichnung: ACMSD

Hintergrund: The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders.

Molekulargewicht: 38 kDa (MW of target protein)